PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.IR2D4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 321aa    MW: 35703.9 Da    PI: 5.1888
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.IR2D4genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.11.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +++ +v  +G g+W++++++ g++R++k+c++rw +yl
      Aradu.IR2D4 14 RGLWTPEEDAKILAYVSNHGIGNWTLVPKKAGLNRCGKSCRLRWTNYL 61
                     788*******************************************97 PP

2Myb_DNA-binding50.93.5e-1668110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +++T++E+el++++++  G++ W++Ia++++ gRt++++k++w++
      Aradu.IR2D4  68 DNFTPQEEELIINLHAAIGSR-WSLIAKRLP-GRTDNDVKNYWNT 110
                      68*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.7E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.275965IPR017930Myb domain
SuperFamilySSF466896.25E-3111108IPR009057Homeodomain-like
SMARTSM007176.1E-141363IPR001005SANT/Myb domain
PfamPF002491.4E-151461IPR001005SANT/Myb domain
CDDcd001671.76E-111761No hitNo description
Gene3DG3DSA:1.10.10.605.8E-2565116IPR009057Homeodomain-like
PROSITE profilePS5129419.09166116IPR017930Myb domain
SMARTSM007174.4E-1566114IPR001005SANT/Myb domain
PfamPF002499.3E-1569110IPR001005SANT/Myb domain
CDDcd001677.16E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGRPPCCDKT NVKRGLWTPE EDAKILAYVS NHGIGNWTLV PKKAGLNRCG KSCRLRWTNY  60
LRPDLKHDNF TPQEEELIIN LHAAIGSRWS LIAKRLPGRT DNDVKNYWNT KLRKKLMNMG  120
IDPVTHKPVS QVLSDLGSIN GLPSTGNQIG LAANKDLMNN MLPTRTEPSN PMVEQTQEEQ  180
TQFWENQVQY QQVLASECVQ PNVVFSEAAS SSSSSSSSNL TQLSSPQQSY NCHNSQITPP  240
CSSSFDWSDF LHGDSIMWSE MQQCDPQRVM SSSEAFGAVA CGASMCEGRS NSGDSFVDGI  300
LDRDSEIRAA FPELLDDAFD Y
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150444e-39AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015945972.10.0PREDICTED: transcription factor MYB35
SwissprotQ9LSI77e-89MYB35_ARATH; Transcription factor MYB35
TrEMBLA0A151RUI01e-151A0A151RUI0_CAJCA; Myb-related protein Zm38
STRINGGLYMA13G04920.11e-150(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF29423474
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.14e-87MYB family protein